McDonnell Genome Institute

Washington University

Transcript

lnc-SCGB1C2-7:1

Chromosome

chr17

Gene Name

lnc-SCGB1C2-7

Start

206417

CPC Label

noncoding

End

206810

Cancer

OV

Strand

+

Peptide

DWASVSYGTLMGK

Modified Peptide

n[145]DWASVSYGTLMGK

Peptide Length

13

ORF Length

90

Open Reading Frame (ORF)

MGKRDWASVSYGTSMRKRDWASVSHGTSMGKHDWASVSYGSSMGKRDWVSVSYGSSMGKRDWASVSYGTSMGKRDWASVSYGTLMGKHDW

Conservation Score

0.998

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.163855

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7072

PhyloCSF Frame 3

0

CNTI Score

-0.469796986