McDonnell Genome Institute

Washington University

Transcript

lnc-SCG3-1:2

Chromosome

chr15

Gene Name

lnc-SCG3-1

Start

51751596

CPC Label

coding

End

51756475

Cancer

OV

Strand

+

Peptide

SLCSPLGR

Modified Peptide

n[145]SLCSPLGR

Peptide Length

8

ORF Length

134

Open Reading Frame (ORF)

LRCRSLCSPLGRSGEGAVSCPPGLRGCVLPLRALFPHFSPSCACLVSSWSGMHLPASFSRRWGGVDWPASFLRSLELSLAGRFSLPVSGLVRILENLIIIVITFLVKVIVVCAPLRLPKCSLLTCGNEGGFLKQ

Conservation Score

1

PhyloCSF Frame 1

4.686

No. of Spectra

2

CPC Coding Probability

0.754061

PhyloCSF Frame 2 

-4.306

CNTI Index

coding

Max Probability

0.9687

PhyloCSF Frame 3

-3.222

CNTI Score

0.722589947