McDonnell Genome Institute

Washington University

Transcript

lnc-SCARB2-1:1

Chromosome

chr4

Gene Name

lnc-SCARB2-1

Start

76239633

CPC Label

noncoding

End

76251837

Cancer

OSCC

Strand

-

Peptide

APGNSDAPLRGPTPSPTPGDVDLAEGRER

Modified Peptide

n[145]APGNSDAPLRGPTPSPTPGDVDLAEGRER

Peptide Length

29

ORF Length

56

Open Reading Frame (ORF)

LPRAPGNSDAPLRGPTPSPTPGDVDLAEGRERVPVLGVITFYSAGKACSSSHRNAP

Conservation Score

0.029

PhyloCSF Frame 1

-5.881

No. of Spectra

1

CPC Coding Probability

0.0585039

PhyloCSF Frame 2 

-4.328

CNTI Index

coding

Max Probability

0.6896

PhyloCSF Frame 3

-4.11

CNTI Score

0.643602142