McDonnell Genome Institute

Washington University

Transcript

lnc-SCAND1-3:1

Chromosome

chr20

Gene Name

lnc-SCAND1-3

Start

36150412

CPC Label

noncoding

End

36155733

Cancer

CCRC

Strand

-

Peptide

VGVTCPR

Modified Peptide

n[230]VGVTCPR

Peptide Length

7

ORF Length

46

Open Reading Frame (ORF)

LRLRVGVTCPRLRLHSYTGSLDYILSTLPNNNPFQKNQAGGSRRDT

Conservation Score

0.984

PhyloCSF Frame 1

-5.307

No. of Spectra

128

CPC Coding Probability

0.22815

PhyloCSF Frame 2 

-5.101

CNTI Index

noncoding

Max Probability

0.9957

PhyloCSF Frame 3

-6.206

CNTI Score

-0.319661385