McDonnell Genome Institute

Washington University

Transcript

lnc-SCAF8-8:1

Chromosome

chr6

Gene Name

lnc-SCAF8-8

Start

154216930

CPC Label

noncoding

End

154217489

Cancer

OSCC

Strand

+

Peptide

HIQVNETPK

Modified Peptide

n[145]HIQVNETPK

Peptide Length

9

ORF Length

93

Open Reading Frame (ORF)

LKDVTLRKQRVPFQPSKGGVGRYAQAKQWGWTQGWWPNKNAAFFLHMFKSAESDAEFKGLDVDSLVTKHIQVNETPKMGHCTFRAHGQMNLYI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0721112

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8139

PhyloCSF Frame 3

0

CNTI Score

-0.359395904