McDonnell Genome Institute

Washington University

Transcript

lnc-SCAF8-7:1

Chromosome

chr6

Gene Name

lnc-SCAF8-7

Start

154549516

CPC Label

noncoding

End

154550242

Cancer

OV

Strand

+

Peptide

SRMVKVGDTLDLLIGEDK

Modified Peptide

n[145]SRMVKVGDTLDLLIGEDK

Peptide Length

18

ORF Length

78

Open Reading Frame (ORF)

LETVVRSFQDDVVLKTSLDIGRNKVEDAFCKGEFRLNGEKLWKKSRMVKVGDTLDLLIGEDKEAGTETVMQILPKKSV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.0156179

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

0

CNTI Score

-0.330850693