McDonnell Genome Institute

Washington University

Transcript

lnc-SCAF8-4:1

Chromosome

chr6

Gene Name

lnc-SCAF8-4

Start

154905219

CPC Label

noncoding

End

154950558

Cancer

OV

Strand

+

Peptide

TGLNAPSMGTSLILPCVAFHCIRAALSCNAK

Modified Peptide

n[145]TGLNAPSMGTSLILPCVAFHCIRAALSCNAK

Peptide Length

31

ORF Length

64

Open Reading Frame (ORF)

LTTKTNPSPPARTGLNAPSMGTSLILPCVAFHCIRAALSCNAKLHNDFPLPLPKTQILCIMLRS

Conservation Score

0.596

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.118737

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2005

PhyloCSF Frame 3

0

CNTI Score

-0.372674582