McDonnell Genome Institute

Washington University

Transcript

lnc-SCAF4-1:3

Chromosome

chr21

Gene Name

lnc-SCAF4-1

Start

31624222

CPC Label

noncoding

End

31659531

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

DGLVVSGSSDHTIR

Modified Peptide

n[145]DGLVVSGSSDHTIR

Peptide Length

14

ORF Length

71

Open Reading Frame (ORF)

LLVLSMGTSESCLQYRDGLVVSGSSDHTIRLLDIECGSCLRVLEGHEELVRCIQFDNKRMVSRAYDGKIKV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.363716

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9614

PhyloCSF Frame 3

0

CNTI Score

0.688823141