McDonnell Genome Institute

Washington University

Transcript

lnc-SCAF4-1:2

Chromosome

chr21

Gene Name

lnc-SCAF4-1

Start

31647209

CPC Label

noncoding

End

31660016

Cancer

PRAD

Strand

-

Peptide

TASMLSPLTGTTGLPMAFLER

Modified Peptide

TASM[147]LSPLTGTTGLPM[147]AFLER

Peptide Length

21

ORF Length

47

Open Reading Frame (ORF)

LPKWEPRQRRCRERVRPLRTASMLSPLTGTTGLPMAFLERQNCCHFH

Conservation Score

0.554

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.31337

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9856

PhyloCSF Frame 3

0

CNTI Score

-0.287288756