McDonnell Genome Institute

Washington University

Transcript

lnc-SBF2-4:1

Chromosome

chr11

Gene Name

lnc-SBF2-4

Start

9711345

CPC Label

noncoding

End

9716109

Cancer

OSCC

Strand

-

Peptide

SQVQVHYLYIHGQRR

Modified Peptide

n[145]SQVQVHYLYIHGQRR

Peptide Length

15

ORF Length

46

Open Reading Frame (ORF)

MSQVQVHYLYIHGQRRGWAWWPMPVIPALWEAEAGGSPEVRSLRPT

Conservation Score

0.983

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0944734

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9665

PhyloCSF Frame 3

0

CNTI Score

-0.374369651