McDonnell Genome Institute

Washington University

Transcript

lnc-SBF2-1:2

Chromosome

chr11

Gene Name

lnc-SBF2-1

Start

10302241

CPC Label

noncoding

End

10304843

Cancer

OV

Strand

-

Peptide

GWPEPWTWGAVASSGPRPPAGLAPDR

Modified Peptide

n[145]GWPEPWTWGAVASSGPRPPAGLAPDR

Peptide Length

26

ORF Length

97

Open Reading Frame (ORF)

MRPGVQSLLAKNSKSPRKGQRGWPEPWTWGAVASSGPRPPAGLAPDRAATPDSRGGAGAGTEQSREEQDSLVPQRTKTPAFRGELVRFHGRDKAQKS

Conservation Score

1

PhyloCSF Frame 1

-3.435

No. of Spectra

1

CPC Coding Probability

0.0838963

PhyloCSF Frame 2 

0.021

CNTI Index

noncoding

Max Probability

0.1765

PhyloCSF Frame 3

-3.248

CNTI Score

-0.277019949