McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-4:9

Chromosome

chr7

Gene Name

lnc-SBDS-4

Start

66526087

CPC Label

noncoding

End

66542549

Cancer

OSCC

Strand

-

Peptide

FQALVQAQGK

Modified Peptide

n[145]FQALVQAQGK

Peptide Length

10

ORF Length

44

Open Reading Frame (ORF)

LHRDPTVRPFSSTDLLMLSLSVVWKCLLGGPHRRFQALVQAQGK

Conservation Score

0.018

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.176468

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9918

PhyloCSF Frame 3

-3.581

CNTI Score

-0.334344996