McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-4:4

Chromosome

chr7

Gene Name

lnc-SBDS-4

Start

66545600

CPC Label

coding

End

66592376

Cancer

OSCC

Strand

-

Peptide

HSPASASQVAGTTAGR

Modified Peptide

n[145]HSPASASQVAGTTAGR

Peptide Length

16

ORF Length

58

Open Reading Frame (ORF)

LEMLWVWFHITAIKWSLALSPRLEFSGTISAHCKLHLRGSRHSPASASQVAGTTAGRR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.533535

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9661

PhyloCSF Frame 3

0

CNTI Score

-0.300792675