McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-29:1

Chromosome

chr7

Gene Name

lnc-SBDS-29

Start

67274873

CPC Label

noncoding

End

67276250

Cancer

OV

Strand

-

Peptide

VLGLQMWATVPSPHCMDFLKK

Modified Peptide

n[145]VLGLQMWATVPSPHCM[147]DFLKK

Peptide Length

21

ORF Length

69

Open Reading Frame (ORF)

MLPRLVSNSWPQVIHLPWPPKVLGLQMWATVPSPHCMDFLKKKKDYICLTYVTPLLSFLKSISLINLVI

Conservation Score

0.635

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0685434

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5831

PhyloCSF Frame 3

0

CNTI Score

-0.36358416