McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-24:1

Chromosome

chr7

Gene Name

lnc-SBDS-24

Start

69232672

CPC Label

noncoding

End

69235987

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

CLCFSFPLPK

Modified Peptide

n[145]CLCFSFPLPK

Peptide Length

10

ORF Length

62

Open Reading Frame (ORF)

MFTFPRREPRSVRAVHELVTVIKALCFSSRNQPSGLGVEFRLTNWLCRCLCFSFPLPKCPCQ

Conservation Score

1

PhyloCSF Frame 1

-3.839

No. of Spectra

1

CPC Coding Probability

0.0672514

PhyloCSF Frame 2 

-3.842

CNTI Index

noncoding

Max Probability

0.75

PhyloCSF Frame 3

-2.334

CNTI Score

-0.382845195