McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-20:1

Chromosome

chr7

Gene Name

lnc-SBDS-20

Start

66556844

CPC Label

noncoding

End

66557362

Cancer

OV

Strand

-

Peptide

DSLLLPPREGGER

Modified Peptide

n[145]DSLLLPPREGGER

Peptide Length

13

ORF Length

69

Open Reading Frame (ORF)

LLAEGLGLKQLLHYERRLLLQLHDAPTLLGHLLGEASVLLLQHKDSLLLPPREGGERQGRAEGPGGGRR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.199835

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3598

PhyloCSF Frame 3

0

CNTI Score

-0.28852537