McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-19:1

Chromosome

chr7

Gene Name

lnc-SBDS-19

Start

66606737

CPC Label

coding

End

66607107

Cancer

EOGC

Strand

-

Peptide

SIAHVLTVINQTQKENLR

Modified Peptide

n[145]SIAHVLTVINQTQKENLR

Peptide Length

18

ORF Length

117

Open Reading Frame (ORF)

MAKIKAPDLRGKKEELLKQLDDLKVELSQLRVAKVTGGAASKLPKILVVRKSIAHVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYLLRQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.588841

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.1023

PhyloCSF Frame 3

0

CNTI Score

0.761454416