McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-15:2

Chromosome

chr7

Gene Name

lnc-SBDS-15

Start

66739906

CPC Label

noncoding

End

66741184

Cancer

HCC

Strand

-

Peptide

KVGAGAR

Modified Peptide

n[230]KVGAGAR

Peptide Length

7

ORF Length

55

Open Reading Frame (ORF)

LLRSQRPGRKVGAGARGAAGEGGGQEMLRVRPSGLGWRWRSRQLASGTERPHSED

Conservation Score

0.203

PhyloCSF Frame 1

-1.642

No. of Spectra

110

CPC Coding Probability

0.154301

PhyloCSF Frame 2 

-2.066

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

-1.489

CNTI Score

-0.270459635