McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-13:1

Chromosome

chr7

Gene Name

lnc-SBDS-13

Start

66839901

CPC Label

noncoding

End

66844847

Cancer

LUAD

Strand

-

Peptide

DFPACSVGR

Modified Peptide

n[230]DFPACSVGR

Peptide Length

9

ORF Length

47

Open Reading Frame (ORF)

LCYYYRRDFPACSVGRSKGLTLSEQALHTKRLSPGGHKQKVRQGQHV

Conservation Score

0.874

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0128409

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0784

PhyloCSF Frame 3

0

CNTI Score

-0.318511148