McDonnell Genome Institute

Washington University

Transcript

lnc-SBDS-11:2

Chromosome

chr7

Gene Name

lnc-SBDS-11

Start

69359081

CPC Label

noncoding

End

69430871

Cancer

HCC

Strand

-

Peptide

NTPWCQK

Modified Peptide

n[230]NTPWCQK

Peptide Length

7

ORF Length

64

Open Reading Frame (ORF)

MASRIPEDSTCREHHWSQKGRGPGAKNTPWCQKKFISLEMQHLLRWSSTFLPRLVLNSWAQVIF

Conservation Score

0.872

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.15507

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.424875614