McDonnell Genome Institute

Washington University

Transcript

lnc-SAXO2-2:2

Chromosome

chr15

Gene Name

lnc-SAXO2-2

Start

82098925

CPC Label

noncoding

End

82101493

Cancer

OSCC

Strand

+

Peptide

ASQTTAHSPPQMVPSQR

Modified Peptide

n[145]ASQTTAHSPPQM[147]VPSQR

Peptide Length

17

ORF Length

97

Open Reading Frame (ORF)

LTTHKTLTMLMLMERAEFFEASWWKFKENNVRASQTTAHSPPQMVPSQRQICNSSELGKMAQDRAMLRMGAIWLIHGCPVLQQGKKKVLITQPQSCI

Conservation Score

0.984

PhyloCSF Frame 1

-2.831

No. of Spectra

4

CPC Coding Probability

0.195827

PhyloCSF Frame 2 

-3.319

CNTI Index

noncoding

Max Probability

0.9387

PhyloCSF Frame 3

-3.234

CNTI Score

-0.350632646