McDonnell Genome Institute

Washington University

Transcript

lnc-SAXO2-2:1

Chromosome

chr15

Gene Name

lnc-SAXO2-2

Start

82097903

CPC Label

noncoding

End

82102922

Cancer

LUAD

Strand

+

Peptide

RLNHSPTVTQSMIGGDWTR

Modified Peptide

n[230]RLNHSPTVTQSM[147]IGGDWTR

Peptide Length

19

ORF Length

76

Open Reading Frame (ORF)

MLSGLSKFTQLVDGDIRIQTLNSLTLVSNSLFILTQEHTHPISVSWCDRGGGPGTRRLNHSPTVTQSMIGGDWTRT

Conservation Score

0.047

PhyloCSF Frame 1

-4.464

No. of Spectra

18

CPC Coding Probability

0.0714363

PhyloCSF Frame 2 

-5.14

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-4.726

CNTI Score

-0.350632646