McDonnell Genome Institute

Washington University

Transcript

lnc-SAT2-1:1

Chromosome

chr17

Gene Name

lnc-SAT2-1

Start

7685259

CPC Label

noncoding

End

7686371

Cancer

BRCA-Luminal B

Strand

-

Peptide

IGVPDQR

Modified Peptide

n[145]IGVPDQR

Peptide Length

7

ORF Length

125

Open Reading Frame (ORF)

LAPNRSVMPTKSQTLFIVPETFHHVSSQSIPDPTFILISITILPVGELHIEWNQAGRCGSRLHFGRPRRADYLRIGVPDQRGQRGESPSLLKNTKISWAWWVPVIPAIREGEAGESLEPGRQRLQ

Conservation Score

0.483

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.145392

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

0

CNTI Score

-0.378842966