McDonnell Genome Institute

Washington University

Transcript

lnc-SASS6-2:11

Chromosome

chr1

Gene Name

lnc-SASS6-2

Start

99937994

CPC Label

noncoding

End

99969901

Cancer

OV

Strand

-

Peptide

TWAALLAAPGSCFTVAWRPGALLSATPLLGARNR

Modified Peptide

n[145]TWAALLAAPGSCFTVAWRPGALLSATPLLGARNR

Peptide Length

34

ORF Length

66

Open Reading Frame (ORF)

LAALSLRRRTWAALLAAPGSCFTVAWRPGALLSATPLLGARNRWSDTRRGPLRDCLFAEGAKVSTA

Conservation Score

0.101

PhyloCSF Frame 1

-0.153

No. of Spectra

2

CPC Coding Probability

0.0572576

PhyloCSF Frame 2 

-1.999

CNTI Index

noncoding

Max Probability

0.5977

PhyloCSF Frame 3

-2.383

CNTI Score

-0.363981051