McDonnell Genome Institute

Washington University

Transcript

lnc-SAP30-22:2

Chromosome

chr4

Gene Name

lnc-SAP30-22

Start

173518771

CPC Label

noncoding

End

173519610

Cancer

OV

Strand

+

Peptide

LGQVSHEETWSIWR

Modified Peptide

n[145]LGQVSHEETWSIWR

Peptide Length

14

ORF Length

127

Open Reading Frame (ORF)

LGQVSHEETWSIWRRFLKTFRREGEFSAEKLNLPYSSGPIWDLSLLTAPEGTAVIFCTACTPRNTLLNQRMSARLSSADRAGSTRAVGFHPSPPPPHAHSHGPSRLRGTLIKCGKQTEADVIALTRS

Conservation Score

1

PhyloCSF Frame 1

1.786

No. of Spectra

2

CPC Coding Probability

0.0369622

PhyloCSF Frame 2 

0.127

CNTI Index

noncoding

Max Probability

0.3993

PhyloCSF Frame 3

-2.163

CNTI Score

-0.374571086