McDonnell Genome Institute

Washington University

Transcript

lnc-SAP30-19:1

Chromosome

chr4

Gene Name

lnc-SAP30-19

Start

173745954

CPC Label

noncoding

End

173748539

Cancer

OV

Strand

+

Peptide

LGSVVVETTLCVSFWEILGR

Modified Peptide

n[145]LGSVVVETTLCVSFWEILGR

Peptide Length

20

ORF Length

36

Open Reading Frame (ORF)

MLGSVVVETTLCVSFWEILGRTLYSFNLMTKQQHAK

Conservation Score

1

PhyloCSF Frame 1

-5.696

No. of Spectra

1

CPC Coding Probability

0.018434

PhyloCSF Frame 2 

-3.748

CNTI Index

noncoding

Max Probability

0.9907

PhyloCSF Frame 3

-5.072

CNTI Score

-0.37281