McDonnell Genome Institute

Washington University

Transcript

lnc-SAP130-3:1

Chromosome

chr2

Gene Name

lnc-SAP130-3

Start

128258853

CPC Label

noncoding

End

128259975

Cancer

OSCC

Strand

-

Peptide

SRVPDQSGQHSK

Modified Peptide

n[145]SRVPDQSGQHSK

Peptide Length

12

ORF Length

44

Open Reading Frame (ORF)

LHFGRLRREDCLKSRVPDQSGQHSKTLSLQKNKIRLDSSGAACL

Conservation Score

0.15

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0205882

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8453

PhyloCSF Frame 3

0

CNTI Score

-0.384124973