McDonnell Genome Institute

Washington University

Transcript

lnc-SAMSN1-2:4

Chromosome

chr21

Gene Name

lnc-SAMSN1-2

Start

14747744

CPC Label

noncoding

End

14753461

Cancer

HCC

Strand

-

Peptide

HALFFSPR

Modified Peptide

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

LFLGQLSEKLECWRHALFFSPRGKRCEEAFCLGTELC

Conservation Score

0.024

PhyloCSF Frame 1

-6.229

No. of Spectra

9

CPC Coding Probability

0.0102828

PhyloCSF Frame 2 

-4.824

CNTI Index

noncoding

Max Probability

0.5655

PhyloCSF Frame 3

-6.195

CNTI Score

-0.408699051