McDonnell Genome Institute

Washington University

Transcript

lnc-SAMHD1-2:1

Chromosome

chr20

Gene Name

lnc-SAMHD1-2

Start

37021742

CPC Label

noncoding

End

37021984

Cancer

EOGC

Strand

-

Peptide

MVDSFFK

Modified Peptide

n[145]MVDSFFK

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

MHHTKGNKKGAKKKMVDSFFKKDWFDVKKHRLCSIQEILERH

Conservation Score

1

PhyloCSF Frame 1

-4.922

No. of Spectra

1

CPC Coding Probability

0.0331067

PhyloCSF Frame 2 

-5.32

CNTI Index

noncoding

Max Probability

0.8279

PhyloCSF Frame 3

0

CNTI Score

-0.372588771