McDonnell Genome Institute

Washington University

Transcript

lnc-SAMD5-2:2

Chromosome

chr6

Gene Name

lnc-SAMD5-2

Start

147702395

CPC Label

noncoding

End

147995630

Cancer

OV

Strand

+

Peptide

CSSVVNWIK

Modified Peptide

n[145]CSSVVNWIK

Peptide Length

9

ORF Length

82

Open Reading Frame (ORF)

MVLPFDPAVPLLSIYPKENKSFYQKDTYTQMFIAALFTTAKTWNQPRCSSVVNWIKKMWYICTMEYYAAIKRMKSCPSQQHG

Conservation Score

0.172

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.126943

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6906

PhyloCSF Frame 3

0

CNTI Score

-0.405717016