McDonnell Genome Institute

Washington University

Transcript

lnc-SAMD12-4:1

Chromosome

chr8

Gene Name

lnc-SAMD12-4

Start

118085494

CPC Label

noncoding

End

118088259

Cancer

PRAD

Strand

-

Peptide

FNGFVALDSISGLGSFLGIEEYSYLR

Modified Peptide

‚Äč

Peptide Length

26

ORF Length

60

Open Reading Frame (ORF)

LYLQSEAKVLVLVLVCEYLMKRFNGFVALDSISGLGSFLGIEEYSYLRKKNSECGKYENY

Conservation Score

0.982

PhyloCSF Frame 1

-2.909

No. of Spectra

2

CPC Coding Probability

0.11515

PhyloCSF Frame 2 

-3.02

CNTI Index

noncoding

Max Probability

0.8111

PhyloCSF Frame 3

-2.613

CNTI Score

-0.444415603