McDonnell Genome Institute

Washington University

Transcript

lnc-SAMD11-7:5

Chromosome

chr1

Gene Name

lnc-SAMD11-7

Start

778791

CPC Label

coding

End

789501

Cancer

BRCA-Basal-like

Strand

+

Peptide

SQVMLMLLDGR

Modified Peptide

n[145]SQVMLMLLDGR

Peptide Length

11

ORF Length

49

Open Reading Frame (ORF)

MHSNPGYPVKFISSSSSEMGCLSTFLTRSQVMLMLLDGRSHFIKQGARL

Conservation Score

0.983

PhyloCSF Frame 1

0

No. of Spectra

48

CPC Coding Probability

0.5

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9951

PhyloCSF Frame 3

0

CNTI Score

0.681088469