McDonnell Genome Institute

Washington University

Transcript

lnc-SAMD11-5:1

Chromosome

chr1

Gene Name

lnc-SAMD11-5

Start

901297

CPC Label

noncoding

End

904811

Cancer

OV

Strand

+

Peptide

VGAALFPAGRAR

Modified Peptide

n[145]VGAALFPAGRAR

Peptide Length

12

ORF Length

173

Open Reading Frame (ORF)

LSTPLSEPQQGRCPEGSPGNPAQRPSGHKVGAALFPAGRARVAGEGALEGQPRGRRPLQTLCPAQHPGELPPHAHLTRFLLHSEWRMGGLGRRAGALEWLRGTRMHKGPVQRTARLPGARGPGLPGPAVFIRSEPSTPVGVEPRTQQRVGGWGAASGQVATPWTQAQDARVRA

Conservation Score

0.36

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0567419

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7413

PhyloCSF Frame 3

0

CNTI Score

-0.265501216