McDonnell Genome Institute

Washington University

Transcript

lnc-SAMD11-13:3

Chromosome

chr1

Gene Name

lnc-SAMD11-13

Start

632769

CPC Label

noncoding

End

633463

Cancer

HCC

Strand

+

Peptide

IFEIGPVFTL

Modified Peptide

n[230]IFEIGPVFTL

Peptide Length

10

ORF Length

42

Open Reading Frame (ORF)

LLHDQGYTTANALKSVEQTSFMPIVLELIPLKIFEIGPVFTL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0464812

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.341990319