McDonnell Genome Institute

Washington University

Transcript

lnc-SAMD11-12:2

Chromosome

chr1

Gene Name

lnc-SAMD11-12

Start

633638

CPC Label

coding

End

634924

Cancer

PRAD

Strand

+

Peptide

MNENLFTSFIAPTILGLPAAVLIILFPPLLIPTSK

Modified Peptide

M[147]NENLFTSFIAPTILGLPAAVLIILFPPLLIPTSK

Peptide Length

35

ORF Length

51

Open Reading Frame (ORF)

LRTKMNENLFTSFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.789522

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

-0.340124298