McDonnell Genome Institute

Washington University

Transcript

lnc-SALL3-5:1

Chromosome

chr18

Gene Name

lnc-SALL3-5

Start

78137222

CPC Label

noncoding

End

78140887

Cancer

OV

Strand

+

Peptide

WRAGAICSRWPHTQR

Modified Peptide

n[145]WRAGAICSRWPHTQR

Peptide Length

15

ORF Length

109

Open Reading Frame (ORF)

MNPSSSFHNYFSFSPEKLFVVVLLRGNIWLMVGTLLFPNLKKKAINFHSPMNGVFPRRWSHQKRGPSVHPACTKSRKWRAGAICSRWPHTQRHHERPLETINSIHAKQK

Conservation Score

0.999

PhyloCSF Frame 1

-0.208

No. of Spectra

1

CPC Coding Probability

0.175144

PhyloCSF Frame 2 

-3.868

CNTI Index

noncoding

Max Probability

0.1215

PhyloCSF Frame 3

-3.094

CNTI Score

-0.336949321