McDonnell Genome Institute

Washington University

Transcript

lnc-SAFB-1:1

Chromosome

chr19

Gene Name

lnc-SAFB-1

Start

5558173

CPC Label

noncoding

End

5581215

Cancer

OV

Strand

+

Peptide

LSSEGGDLGQAK

Modified Peptide

n[145]LSSEGGDLGQAK

Peptide Length

12

ORF Length

60

Open Reading Frame (ORF)

LHVICILFVKCQNTLKMLSPTSTPSGEAGNPSPLPPPAPGMGWGRLSSEGGDLGQAKSHL

Conservation Score

1

PhyloCSF Frame 1

-4.299

No. of Spectra

1

CPC Coding Probability

0.0585554

PhyloCSF Frame 2 

-3.845

CNTI Index

noncoding

Max Probability

0.2004

PhyloCSF Frame 3

-4.785

CNTI Score

-0.347867736