McDonnell Genome Institute

Washington University

Transcript

lnc-SACS-7:1

Chromosome

chr13

Gene Name

lnc-SACS-7

Start

22978312

CPC Label

noncoding

End

22979571

Cancer

EOGC

Strand

-

Peptide

DPSALEEGAR

Modified Peptide

n[145]DPSALEEGAR

Peptide Length

10

ORF Length

40

Open Reading Frame (ORF)

LAETTICSHGDSGMLFLQRDPSALEEGARKENKAASTEEY

Conservation Score

0.079

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0827447

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

0

CNTI Score

-0.465587445