McDonnell Genome Institute

Washington University

Transcript

lnc-SAAL1-1:1

Chromosome

chr11

Gene Name

lnc-SAAL1-1

Start

18112472

CPC Label

noncoding

End

18116132

Cancer

OV

Strand

-

Peptide

TPITSDLLACQR

Modified Peptide

n[145]TPITSDLLACQR

Peptide Length

12

ORF Length

111

Open Reading Frame (ORF)

LMLPGMSEQSLTALDSQERAMPERTSRDSQETMQRIRWLARLPTNGARVAKTPITSDLLACQRNTELPFQSALRRPGCEPLRAGTFVDLQLLNSISLVLDIEHIKMLNKCL

Conservation Score

1

PhyloCSF Frame 1

2.741

No. of Spectra

9

CPC Coding Probability

0.419029

PhyloCSF Frame 2 

-4.684

CNTI Index

noncoding

Max Probability

0.8263

PhyloCSF Frame 3

-2.127

CNTI Score

-0.361038917