McDonnell Genome Institute

Washington University

Transcript

lnc-S100A10-1:1

Chromosome

chr1

Gene Name

lnc-S100A10-1

Start

151949522

CPC Label

noncoding

End

151950912

Cancer

OV

Strand

-

Peptide

LDTEFTTYGK

Modified Peptide

n[145]LDTEFTTYGK

Peptide Length

10

ORF Length

79

Open Reading Frame (ORF)

LDTEFTTYGKLPEDKDSSLESGMQNMSIHTKTTSGCSDGLSSAYWASQALASITAWVPALTLARALTPSAVPALPRPRF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.105364

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8993

PhyloCSF Frame 3

0

CNTI Score

0.74459198