McDonnell Genome Institute

Washington University

Transcript

lnc-RYR2-7:1

Chromosome

chr1

Gene Name

lnc-RYR2-7

Start

238590437

CPC Label

noncoding

End

238627437

Cancer

EOGC

Strand

+

Peptide

IYLFLDCIK

Modified Peptide

n[145]IYLFLDCIK

Peptide Length

9

ORF Length

42

Open Reading Frame (ORF)

MTFVVLSIILVDLQRIIEKIYLFLDCIKIIFDSFYNFKMCPN

Conservation Score

0.349

PhyloCSF Frame 1

-5.208

No. of Spectra

1

CPC Coding Probability

0.0697256

PhyloCSF Frame 2 

-6.069

CNTI Index

noncoding

Max Probability

0.7392

PhyloCSF Frame 3

-5.362

CNTI Score

-0.357691668