McDonnell Genome Institute

Washington University

Transcript

lnc-RYBP-6:2

Chromosome

chr3

Gene Name

lnc-RYBP-6

Start

72118208

CPC Label

noncoding

End

72183117

Cancer

OV

Strand

-

Peptide

LYCIIVLR

Modified Peptide

n[145]LYCIIVLR

Peptide Length

8

ORF Length

36

Open Reading Frame (ORF)

LYCIIVLRETSIKHLLRFRHNAKCLKCMFHSYITLM

Conservation Score

0.037

PhyloCSF Frame 1

-4.757

No. of Spectra

7

CPC Coding Probability

0.0610667

PhyloCSF Frame 2 

-4.552

CNTI Index

noncoding

Max Probability

0.8317

PhyloCSF Frame 3

-4.324

CNTI Score

-0.348771356