McDonnell Genome Institute

Washington University

Transcript

lnc-RYBP-1:1

Chromosome

chr3

Gene Name

lnc-RYBP-1

Start

72321050

CPC Label

noncoding

End

72324027

Cancer

PRAD

Strand

-

Peptide

DISQFLSVSVCCHVGDRPR

Modified Peptide

DISQFLSVSVCCHVGDRPR

Peptide Length

19

ORF Length

146

Open Reading Frame (ORF)

LRQGAAGPMAKESASVTAKRDRDISQFLSVSVCCHVGDRPRLARASGSLREARNLNFHVKFTGIFLRQFIQTLQKHCMGQISHLCELNAAHGQSAGKLWGKRNKEEAGAEPWGHGCRVCSLKEITGGRRFWERVGWSAGYHRRPRV

Conservation Score

0.206

PhyloCSF Frame 1

-5.139

No. of Spectra

5

CPC Coding Probability

0.31728

PhyloCSF Frame 2 

-4.342

CNTI Index

noncoding

Max Probability

0.8449

PhyloCSF Frame 3

-5.144

CNTI Score

-0.335471704