McDonnell Genome Institute

Washington University

Transcript

lnc-RXRA-2:1

Chromosome

chr9

Gene Name

lnc-RXRA-2

Start

134267523

CPC Label

coding

End

134268809

Cancer

BRCA-Luminal A

Strand

+

Peptide

VTCILCGLR

Modified Peptide

n[145]VTCILCGLR

Peptide Length

9

ORF Length

67

Open Reading Frame (ORF)

LSSAPWAGFRSSAAARGPRVTCILCGLRWSGSWRGRRGKPRGMGKWLQPSTAPPSHVSVQSDLGLGA

Conservation Score

0.099

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.552122

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

0

CNTI Score

-0.322161613