McDonnell Genome Institute

Washington University

Transcript

lnc-RXFP4-2:2

Chromosome

chr1

Gene Name

lnc-RXFP4-2

Start

155978638

CPC Label

coding

End

155983018

Cancer

OSCC

Strand

+

Peptide

SSSSLPWLSSGAR

Modified Peptide

n[145]SSSSLPWLSSGAR

Peptide Length

13

ORF Length

76

Open Reading Frame (ORF)

LPLRVSHFSGETRSTERPGTEPSVSRVLPDSGPKGRGRRREGGETQPRSSSSLPWLSSGARLQVSSPTQHSCRCQF

Conservation Score

1

PhyloCSF Frame 1

-1.469

No. of Spectra

4

CPC Coding Probability

0.606698

PhyloCSF Frame 2 

-3.618

CNTI Index

noncoding

Max Probability

0.2694

PhyloCSF Frame 3

-3.417

CNTI Score

-0.345890634