McDonnell Genome Institute

Washington University

Transcript

lnc-RXFP2-2:2

Chromosome

chr13

Gene Name

lnc-RXFP2-2

Start

32038237

CPC Label

noncoding

End

32040278

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LLSCQFKR

Modified Peptide

n[145]LLSCQFKR

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

LLSCQFKRVEIFFEKAFKSALSAFINSNLIYNSDCFCCS

Conservation Score

1

PhyloCSF Frame 1

-4.748

No. of Spectra

1

CPC Coding Probability

0.0170176

PhyloCSF Frame 2 

-3.549

CNTI Index

noncoding

Max Probability

0.1087

PhyloCSF Frame 3

-4.392

CNTI Score

-0.405725384