McDonnell Genome Institute

Washington University

Transcript

lnc-RXFP2-1:2

Chromosome

chr13

Gene Name

lnc-RXFP2-1

Start

31950158

CPC Label

coding

End

31953441

Cancer

CCRC

Strand

+

Peptide

KLATPAEDDEDDDIDLFGSDNEATQLR

Modified Peptide

n[230]KLATPAEDDEDDDIDLFGSDNEATQLR

Peptide Length

27

ORF Length

62

Open Reading Frame (ORF)

LNVLEKSLPGHWATAPQTQHMSPMRQVEPPAKKLATPAEDDEDDDIDLFGSDNEATQLRHYQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.848567

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8576

PhyloCSF Frame 3

0

CNTI Score

0.769851983