McDonnell Genome Institute

Washington University

Transcript

lnc-RXFP1-2:2

Chromosome

chr4

Gene Name

lnc-RXFP1-2

Start

158210485

CPC Label

noncoding

End

158211906

Cancer

BRCA-Luminal A

Strand

+

Peptide

LNSVNVSMLK

Modified Peptide

n[145]LNSVNVSM[147]LK

Peptide Length

10

ORF Length

34

Open Reading Frame (ORF)

LNSVNVSMLKCASVCLPQPHPYRGCFLNSNVFLF

Conservation Score

0.248

PhyloCSF Frame 1

-5.117

No. of Spectra

9

CPC Coding Probability

0.006942

PhyloCSF Frame 2 

-3.945

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

-3.019

CNTI Score

-0.383069047