McDonnell Genome Institute

Washington University

Transcript

lnc-RWDD4-2:6

Chromosome

chr4

Gene Name

lnc-RWDD4-2

Start

183461324

CPC Label

noncoding

End

183506336

Cancer

OV

Strand

-

Peptide

LIQMMSPYVAQAGLK

Modified Peptide

n[145]LIQM[147]M[147]SPYVAQAGLK

Peptide Length

15

ORF Length

70

Open Reading Frame (ORF)

LIQMMSPYVAQAGLKLLGSSDLPASASQIAGITGMNHCPWPKRIFYFYIFIFNFFEMEFHSCHPGWSAMA

Conservation Score

0.292

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.125352

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8974

PhyloCSF Frame 3

0

CNTI Score

0.762548254