McDonnell Genome Institute

Washington University

Transcript

lnc-RWDD4-2:2

Chromosome

chr4

Gene Name

lnc-RWDD4-2

Start

183501948

CPC Label

noncoding

End

183505066

Cancer

BRCA-Luminal B

Strand

-

Peptide

LASEWDPGGEAAR

Modified Peptide

n[145]LASEWDPGGEAAR

Peptide Length

13

ORF Length

148

Open Reading Frame (ORF)

LRLASEWDPGGEAARSFVPSSPLGGAAPAPLGSLRPATPAFSPSGGPSAAPREPAKEQQAVPFRTTWSEACGTARPGGRRAAPGMRGGCVPAASELAWGCRPPPAGPSGSPGTAGLDQGGRRCSLRPPASCALRVSWPFPYAGIFCVI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0964535

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8899

PhyloCSF Frame 3

0.139

CNTI Score

-0.26541811